adjuvant peptide

adjuvant peptide
адъювант-пептид

English-russian biological dictionary. 2013.

Игры ⚽ Нужен реферат?

Смотреть что такое "adjuvant peptide" в других словарях:

  • Glucagon-like peptide-2 — (GLP 2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP 2 is created by specific post translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon like… …   Wikipedia

  • Polyclonal antibodies — This article deals exclusively with the production of antibodies in vivo. For its medical and biological applications, see Antiserum. Polyclonal antibodies (or antisera) are antibodies that are obtained from different B cell resources. They are a …   Wikipedia

  • Polysaccharide-K — Polysaccharide K, also known as PSK, is a proteoglycan found in the polypore fungus Trametes versicolor. The results obtained from a large number of published scientific studies and clinical trials show that PSK is a powerful immunomodulator… …   Wikipedia

  • Stratégies pour franchir la barrière hémato-encéphalique — Traduction à relire …   Wikipédia en Français

  • List of oncology-related terms — This is a list of terms related to oncology. The original source for this list was the U.S. National Cancer Institute s public domain Dictionary of Cancer Terms . NOTOC 1 * 10 propargyl 10 deazaaminopterin * 12 O tetradecanoylphorbol 13 acetate * …   Wikipedia

  • Paludisme — Classifications CIM du Paludisme Classification et ressources externes Frottis sanguin révélant la présence du parasite Plasmodium falciparum ayant la forme d anneaux à l intérieur d hématies humaines …   Wikipédia en Français

  • TLR-2/translation of German TLR-2 page — TLR 2 is the name of a biomolecule that plays a role in the human immune system. It is a membrane protein, referred to as a receptor, that sits on the surface of certain cells and is able to recognize foreign or host molecules and transmit… …   Wikipedia

  • Krebsimmuntherapie — ist die Bezeichnung für verschiedene Methoden der Immuntherapie zur Behandlung von Krebserkrankungen. Die klassischen Behandlungsmethoden bei Krebs sind die operative Tumorentfernung (Resektion), die Chemotherapie und die Strahlentherapie. Häufig …   Deutsch Wikipedia

  • Trametes versicolor — Scientific classification Kingdom …   Wikipedia

  • Malaria vaccine — Malaria vaccines are an area of intensive research. However, there is no effective vaccine that has been introduced into clinical practice. The global burden of P. falciparum malaria increased through the 1990s due to drug resistant parasites and …   Wikipedia

  • Chang Yi Wang — Born December 19, 1951 (1951 12 19) (age 59) Taip …   Wikipedia


Поделиться ссылкой на выделенное

Прямая ссылка:
Нажмите правой клавишей мыши и выберите «Копировать ссылку»